PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART01G37720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 448aa    MW: 48052.1 Da    PI: 8.3163
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART01G37720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.2e-17116162148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT +Ede l++ v ++G + W+tIa+ ++ gR +kqc++rw ++l
  OBART01G37720.1 116 KGAWTRQEDEVLKQMVILHGDRKWATIAKSLP-GRIGKQCRERWTNHL 162
                      79******************************.************996 PP

2Myb_DNA-binding55.41.4e-17168210145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+e+d  l++a+k +G++ W+ Iar+++ gR+++ +k++w+
  OBART01G37720.1 168 KDVWTEEDDRTLIEAHKTYGNR-WSVIARCLP-GRSENAVKNHWN 210
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.482111166IPR017930Myb domain
SuperFamilySSF466892.17E-29113209IPR009057Homeodomain-like
SMARTSM007177.8E-16115164IPR001005SANT/Myb domain
PfamPF002492.4E-15116162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-23117167IPR009057Homeodomain-like
CDDcd001671.52E-14118162No hitNo description
PROSITE profilePS5129418.239167217IPR017930Myb domain
SMARTSM007171.1E-17167215IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-21168214IPR009057Homeodomain-like
PfamPF002493.0E-15168210IPR001005SANT/Myb domain
CDDcd001671.90E-14171213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MLPTSKNKLM AAAGNSFLNQ DSTMMGSGMP HMYFASSSHG TGAHYQSPGG APITMAVPDM  60
GFLVAGIGMA PSSFVMPEGA LAASYSAMAT VPVGVVVPQQ QSSRFGGNNG NPGSFKGAWT  120
RQEDEVLKQM VILHGDRKWA TIAKSLPGRI GKQCRERWTN HLRPDIKKDV WTEEDDRTLI  180
EAHKTYGNRW SVIARCLPGR SENAVKNHWN ATKRSLKSKR RMKKKSVQVV NSPPGQLSPL  240
EEYIRSQYPS AVETTPPPPA VPAPPSDVIV HGAGSVSAGP TVATQEPTGT NPSQMGIYLG  300
LGNPAGPTTQ QLAAMNLNMS LAPDLNAYND QREGYYLPFV PQGNLHYGMH VPAPPVQQQQ  360
QQGISVDQGL HSSCLSLYHP FPGTHPVSLD FGCQSSNHAN AGGYYSEAGP SSGSGSGDPD  420
DVDVIQMASR QFLMPSEAEV TLDLTRFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-421102181110B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879950.0AK287995.1 Oryza sativa Japonica Group cDNA, clone: J075101C16, full insert sequence.
GenBankFJ9402150.0FJ940215.1 Oryza sativa Japonica Group clone KCS005D12 Myb protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645142.10.0PREDICTED: uncharacterized protein LOC4324828
TrEMBLA0A0D3EWF00.0A0A0D3EWF0_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g63680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.18e-44myb domain protein 118